You have no items in your shopping cart.
Cart summary
Human CEACAM6 Protein
Catalog Number: orb1476703
| Catalog Number | orb1476703 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 6(CEACAM6)(Active) |
| Tag | C-terminal 10xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| MW | 32.6 kDa |
| UniProt ID | P40199 |
| Protein Sequence | KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG |
| Protein Length | Full Length of Mature Protein |
| Source | Mammalian cell |
| Expression System | Expression Region: 35-320aa. Protein Length: Full Length of Mature Protein |
| Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 μg/mL can bind Human CEACAM8 (CSB-MP005168HU), the EC50 is 144.7-223.8 ng/mL.②Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 μg/mL can bind Anti- CEACAM5/CEACAM6 recombinant antibody (CSB-RA005165MA2HU), the EC50 is 0.9430-1.377 ng/mL. |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Alternative names | (Non-specific crossreacting antigen)(Normal cross- Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human CEACAM-6 / CD66c Protein [orb257336]
Unconjugated
95%
32.0 kDa
Human CEACAM-6, His Tag (orb257336) is expressed from human 293 cells (HEK293). It contains AA Lys 35 - Gly 320 (Accession # NP_002474.3).
1 mg, 100 μg Human CEACAM6 protein [orb383282]
Greater than 90% as determined by SDS-PAGE.
47.2 kDa
E.coli
20 μg, 100 μg, 1 mgHuman CEACAM6 Protein, His Tag [orb1173762]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 32.1 kDa after removal of the signal peptide. The apparent molecular mass of CEACAM6-His is approximately 35-55 kDa due to glycosylation.
Mammalian
100 μg, 10 μg, 50 μgHuman CEACAM6 ELISA Kit [orb405954]
Human
0.83 ng/mL-20 ng/mL
0.33 ng/mL
48 t, 24T, 10 x 96 t, 96 t, 5 x 96 tRecombinant Human CD66C/CEACAM6 Protein, His Tag [orb1553392]
≥90% as determined by SDS-PAGE
This protein contains the human CEACAM6(Met1-Gly320) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars