You have no items in your shopping cart.
Featured
Active
Description
Research Area
Cell Biology
Images & Validation
−
Item 1 of 3
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | ①Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 μg/mL can bind Human CEACAM8, the EC50 is 144.7-223.8 ng/mL.②Measured by its binding ability in a functional ELISA. Immobilized Human CEACAM6 at 2 μg/mL can bind Anti- CEACAM5/CEACAM6 recombinant antibody, the EC50 is 0.9430-1.377 ng/mL. |
| Tag | C-terminal 10xHis-tagged |
| Expression Region | 35-320aa |
| Protein Length | Full Length of Mature Protein |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 32.6 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDGPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−(Non-specific crossreacting antigen)(Normal cross-reacting antigen)(CD66c)
Similar Products
−
Recombinant Human CEACAM6 Protein [orb2992780]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. (QC verified)
Predicted: 32.3 KDa. Observed: 35-65 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 4
- Item 1 of 2
CD66c/CEACAM6 Human Monoclonal Antibody [orb2977371]
ELISA, FA, FACS, In vivo
Human
Human
Monoclonal
Unconjugated
100 μg, 1 mg - Item 1 of 2
- Item 1 of 2
Human CEACAM6 Protein, His Tag [orb1173762]
Unconjugated
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 32.1 kDa after removal of the signal peptide. The apparent molecular mass of CEACAM6-His is approximately 35-55 kDa due to glycosylation.
Mammalian
50 μg, 10 μg, 100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 5-10 working days