You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb245788 |
---|---|
Category | Proteins |
Description | Recombinant human Carcinoembryonic antigen-related cell adhesion molecule 4 |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 14.7 kDa |
UniProt ID | O75871 |
Protein Sequence | FTIEALPSSAAEGKDVLLLACNISETIQAYYWHKGKTAEGSPLIAGYITDIQANIPGAAYSGRETVYPNGSLLFQNITLEDAGSYTLRTINASYDSDQATGQLHVHQNNVPGLPVGAVAG |
Protein Length | Partial |
Source | Yeast |
Expression System | Expression Region: 36-155aa. Protein Length: Partial |
Expression Region | 36-155aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | CEACAM4 Read more... |
Note | For research use only |
Application notes | This is His-tag protein |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
32.0 kDa | |
Human CEACAM-6, His Tag (orb257336) is expressed from human 293 cells (HEK293). It contains AA Lys 35 - Gly 320 (Accession # NP_002474.3). |
Unconjugated | |
95% | |
32.2 kDa | |
Human CEACAM-8, His Tag (orb257338) is expressed from human 293 cells (HEK293). It contains AA Gln 35 - Ser 319 (Accession # NP_001807.2). |
Greater than 90% as determined by SDS-PAGE. | |
16.7 kDa | |
E.coli |
Unconjugated | |
95% | |
57.7 kDa | |
Human CEACAM-6, Fc Tag (orb1496249) is expressed from human 293 cells (HEK293). It contains AA Lys 35 - Gly 320 (Accession # P40199-1). |
Unconjugated | |
90% | |
33.5 kDa | |
Rhesus macaque CEACAM-6, His Tag (orb1743050) is expressed from human 293 cells (HEK293). It contains AA Gln 35 - Gly 320 (Accession # XP_014979566.2). |
Filter by Rating