You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb8438 |
---|---|
Category | Proteins |
Description | Recombinant of human CEACAM3 protein |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 29.1 kDa |
UniProt ID | P40198 |
Protein Sequence | KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG |
Protein Length | Extracellular Domain |
Source | E.coli |
Expression System | Expression Region: 35-155aa. Protein Length: Extracellular Domain |
Expression Region | 35-155aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Carcinoembryonic antigen CGM1 CD_antigen, CD66d Read more... |
Note | For research use only |
Application notes | Tag info: N-terminal 6xHis-SUMO-tagged Expression Region: 35-155aaSequence Info: Extracellular DomainGlycerol content: 0.5 |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
32.0 kDa | |
Human CEACAM-6, His Tag (orb257336) is expressed from human 293 cells (HEK293). It contains AA Lys 35 - Gly 320 (Accession # NP_002474.3). |
Unconjugated | |
95% | |
32.2 kDa | |
Human CEACAM-8, His Tag (orb257338) is expressed from human 293 cells (HEK293). It contains AA Gln 35 - Ser 319 (Accession # NP_001807.2). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
Human cells |
≥90% as determined by SDS-PAGE | |
This protein contains the human CEACAM3(Met1-Gly155) was fused with the C-terminal His Tag and expressed in Mammalian cells. |
Filter by Rating