You have no items in your shopping cart.
Cart summary
Human CD69 Protein
Catalog Number: orb1476837
| Catalog Number | orb1476837 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Early activation antigen CD69(CD69),partial |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| MW | 18.0 kDa |
| UniProt ID | Q07108 |
| Protein Sequence | GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK |
| Protein Length | Extracellular Domain |
| Source | Mammalian cell |
| Expression System | Expression Region: 62-199aa. Protein Length: Extracellular Domain |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized Human CD69 at 2 μg/mL can bind Anti-CD69 recombinant antibody (CSB-RA004952MA1HU), the EC50 is 23.17-26.04 ng/mL. |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Alternative names | (Activation inducer molecule)(AIM)(BL-AC/P26)(C-ty Read more... |
| Note | For research use only |
| Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human CD69 / CLEC2C Protein [orb257304]
Unconjugated
95%
16.8 kDa
Human CD69, His Tag (orb257304) is expressed from human 293 cells (HEK293). It contains AA Ser 62 - Lys 199 (Accession # AAH07037).
1 mg, 100 μg Human CD69 Protein, hFc Tag [orb1173857]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 42.1 kDa after removal of the signal peptide.The apparent molecular mass of hFc-CD69 is approximately 55-70 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μgHuman CD69 protein [orb706898]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgRecombinant Human CD69 Protein, His Tag [orb1553387]
≥90% as determined by SDS-PAGE
This protein contains the human CD69(Ser62-Lys199) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μgRecombinant Human CD69 Protein, His Tag [orb1551388]
> 95% by SDS-PAGE.
KMP1099, Recombinant Human CD69 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ser 62 - Lys 199 ) of human CD69 (Accession #NP_001772.1) fused with a 6×His Tag at the C-terminus.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars