Human CD69 Protein

• Catalog Number: orb1476837
• Category: Proteins
• Description: Recombinant Human Early activation antigen CD69(CD69),partial
• Tag: N-terminal 6xHis-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Purity: Greater than 85% as determined by SDS-PAGE.
• MW: 18.0 kDa
• UniProt ID: Q07108
• Protein Sequence: GQYNCPGQYTFSMPSDSHVSSCSEDWVGYQRKCYFISTVKRSWTSAQNACSEHGATLAVIDSEKDMNFLKRYAGREEHWVGLKKEPGHPWKWSNGKEFNNWFNVTGSDKCVFLKNTEVSSMECEKNLYWICNKPYK
• Protein Length: Extracellular Domain
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human CD69 at 2 μg/mL can bind Anti-CD69 recombinant antibody, the EC50 is 23.17-26.04 ng/mL.
• Expression Region: 62-199aa
• Endotoxins: Not test.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Alternative names: (Activation inducer molecule)(AIM)(BL-AC/P26)(C-ty
• Note: For research use only
• Application notes: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Expiration Date: 6 months from date of receipt.