You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb605300 |
---|---|
Category | Proteins |
Description | Recombinant Human CD48 antigen(CD48) |
Tag | N-terminal hFc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 48.3 kDa |
UniProt ID | P09326 |
Protein Sequence | QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQKEDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKELQNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARS |
Protein Length | Full Length of Mature Protein |
Source | Yeast |
Expression System | Expression Region: 27-220aa. Protein Length: Full Length of Mature Protein |
Expression Region | 27-220aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | B-lymphocyte activation marker BLAST-1 BCM1 surfac Read more... |
Note | For research use only |
Application notes | Full Length of Mature Protein |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
23.1 kDa | |
Human 2B4, His Tag (orb257160) is expressed from human 293 cells (HEK293). It contains AA Cys 22 - Arg 221 (Accession # Q9BZW8-2). |
Unconjugated | |
95% | |
48.9 kDa | |
Human 2B4, Fc Tag (orb257161) is expressed from human 293 cells (HEK293). It contains AA Cys 22 - Arg 221 (Accession # Q9BZW8-2). |
Unconjugated | |
95% | |
22.3 kDa | |
Human CD2, His Tag (orb257260) is expressed from human 293 cells (HEK293). It contains AA Lys 25 - Asp 209 (Accession # AAH33583). |
Unconjugated | |
95% | |
23.2 kDa | |
Human CD48, His Tag (orb257218) is expressed from human 293 cells (HEK293). It contains AA Gln 27 - Ser 220 (Accession # AAH16182). |
Greater than 95% as determined by SDS-PAGE. | |
51.3 kDa | |
Mammalian cell |
Filter by Rating