You have no items in your shopping cart.
Featured
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| Expression Region | 18-259aa |
| Protein Length | Extracellular Domain |
| MW | 46.7 kDa |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVH |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Sialic acid-binding Ig-like lectin 3 Short name, Siglec-3 gp67 CD_antigen, CD33 SIGLEC3
Similar Products
−- Item 1 of 1
Human Sialic Acid Binding Ig Like Lectin 6 (SIGLEC6) ELISA Kit [orb778995]
Human
0.16-10 ng/mL
0.057 ng/mL
96 T, 48 T 
Recombinant Human Siglec-6 Protein [orb2993049]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 60.6 KDa. Observed: 70-90 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mgRecombinant Human Siglec-15 Protein (Biotin) [orb2993902]
Biotin
SDS-PAGE: Greater than 90% as determined by reducing SDS-PAGE.. SEC-HPLC: Greater than 90% as determined by SEC-HPLC.(QC verified)
Predicted: 55.3 KDa. Observed: 58-75 KDa, reducing conditions
20 μg, 100 μgRecombinant Cynomolgus Siglec-15 Protein [orb2993817]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 53.1 KDa. Observed: 55-70 KDa, reducing conditions
1 mg, 10 μg, 50 μg, 500 μgRecombinant Human Siglec-15 Protein [orb2994021]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 53.5 KDa. Observed: 50-80 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human CD33 protein (orb603967)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 4-5 weeks