You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb605197 |
---|---|
Category | Proteins |
Description | Recombinant Human T-cell-specific surface glycoprotein CD28(CD28),partial |
Tag | C-terminal hFc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 44.1 kDa |
UniProt ID | P10747 |
Protein Sequence | NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP |
Protein Length | Extracellular Domain |
Source | Mammalian cell |
Expression System | Expression Region: 19-152aa. Protein Length: Extracellular Domain |
Expression Region | 19-152aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | TP44 (CD_antigen, CD28) Read more... |
Note | For research use only |
Application notes | Extracellular Domain |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
42.1 kDa | |
Human PD-1, Fc Tag, low endotoxin (orb257753) is expressed from human 293 cells (HEK293). It contains AA Leu 25 - Gln 167 (Accession # NP_005009.2). |
Unconjugated | |
90% | |
19.0 kDa | |
Human PD-1, Strep Tag (orb257756) is expressed from human 293 cells (HEK293). It contains AA Leu 25 - Gln 167 (Accession # Q15116-1). |
Unconjugated | |
98% | |
26.0 kDa | |
Human PD-L1, His Tag (orb257752) is expressed from human 293 cells (HEK293). It contains AA Phe 19 - Arg 238 (Accession # NP_054862.1 ). |
Unconjugated | |
95% | |
51.3 kDa | |
Human PD-L1, Fc Tag (orb257754) is expressed from human 293 cells (HEK293). It contains AA Phe 19 - Arg 238 (Accession # NP_054862.1). |
Unconjugated | |
95% | |
16.8 kDa | |
Human PD-1, His Tag (orb257751) is expressed from human 293 cells (HEK293). It contains AA Leu 25 - Gln 167 (Accession # NP_005009.2). |
Filter by Rating