You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human CD28 protein
Catalog Number: orb605197
| Catalog Number | orb605197 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human T-cell-specific surface glycoprotein CD28(CD28),partial |
| Tag | C-terminal hFc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Protein Sequence | NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP |
| Protein Length | Extracellular Domain |
| UniProt ID | P10747 |
| MW | 44.1 kDa |
| Application notes | Extracellular Domain |
| Endotoxins | Not test. |
| Source | Mammalian cell |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 19-152aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | TP44 (CD_antigen, CD28) |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 4
Recombinant human/Cyn. monkey/rhesus macaque CD28 protein, N-His-Avi (HEK293) [orb1516480]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 36-52 kDa based on Tris-Bis PAGE result.
100 μg - Item 1 of 4
Anti-ICOS Antibody [orb402341]
ELISA, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
10 μg, 100 μg - Item 1 of 3
Recombinant human/Cyn. monkey/rhesus macaque CD28 protein, N-His-Avi (HEK293), Biotin conjugated [orb2328764]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 38-50 kDa based on Tris-Bis PAGE result.
20 μg - Item 1 of 2
Recombinant human CD86 / B7-2 protein, C-His-Avi (HEK293) [orb1516532]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 55-70 kDa based on Tris-Bis PAGE result.
50 μg, 100 μg - Item 1 of 2
Recombinant human CD80 protein, C-His-Avi (HEK293) [orb1516533]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 50-70 kDa based on Tris-Bis PAGE result.
50 μg, 100 μg
