You have no items in your shopping cart.
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−
Item 1 of 3
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 μg/ml can bind Anti- PD-L1 mouse monoclonal antibody (antigen from E.coli), the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL. |
| Tag | C-terminal hFc1-tagged |
| Expression Region | 19-238aa |
| Protein Length | Partial |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
| MW | 52.7 kDa |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Protein Sequence | FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−PD-L1 (PDCD1 ligand 1) (Programmed death ligand 1) (hPD-L1) (B7 homolog 1) (B7-H1) (CD274)
Similar Products
−- Item 1 of 10
- Item 1 of 9
- Item 1 of 5
CD274/PD-L1/B7-H1 Mouse Monoclonal Antibody [orb2956886]
Functional Studies
Human
Mouse
Monoclonal
Unconjugated
1 mg, 100 μg - Item 1 of 5
CD274/PD-L1/B7-H1 Human Monoclonal Antibody [orb2958447]
ELISA, WB
Human
Human
Monoclonal
Unconjugated
1 mg, 50 μg, 100 μg - Item 1 of 5
Recombinant human PD-L1 protein, C-His (HEK293) [orb1516352]
>95% as determined by Tris-Bis PAGE; >95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 35-42 kDa based on Tris-Bis PAGE result.
100 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
Available Sizes
Select a size below
Usually dispatched within 1-2 weeks