Human CD274 protein

• Catalog Number: orb605286
• Category: Proteins
• Description: Recombinant Human Programmed cell death 1 ligand 1(CD274),partial
• Tag: C-terminal hFc-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 52.7 kDa
• UniProt ID: Q9NZQ7
• Protein Sequence: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
• Protein Length: Partial
• Source: Mammalian cell
• Expression System: Expression Region: 19-238aa. Protein Length: Partial
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 μg/ml can bind Anti- PD-L1 mouse monoclonal antibody(CSB-MA878942A1m，antigen from E.coli), the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL.
• Expression Region: 19-238aa
• Endotoxins: Less than 1.0 EU/ug as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
• Alternative names: PD-L1 (PDCD1 ligand 1) (Programmed death ligand 1)
• Note: For research use only
• Application notes: Extracellular Domain
• Expiration Date: 6 months from date of receipt.