You have no items in your shopping cart.
Featured
Active
Description
Research Area
Immunology & Inflammation
Images & Validation
−Item 1 of 3
| Application Notes |
|---|
Key Properties
−| Source | Mammalian cell |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 μg/ml can bind Anti- PD-L1 mouse monoclonal antibody, the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL. |
| Tag | C-terminal hFc1-tagged |
| Molecular Weight | 52.7 kDa |
| Expression Region | 19-238aa |
| Protein Length | Partial |
| Protein Sequence | FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−PD-L1 (PDCD1 ligand 1) (Programmed death ligand 1) (hPD-L1) (B7 homolog 1) (B7-H1) (CD274)
Similar Products
−- Item 1 of 10
- Item 1 of 9
- Item 1 of 5
Recombinant human PD-L1 protein, C-His (HEK293) [orb1516352]
>95% as determined by Tris-Bis PAGE; >95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 35-42 kDa based on Tris-Bis PAGE result.
100 μg - Item 1 of 1
Human Programmed Cell Death Protein 1 Ligand 1 (PDL1) ELISA Kit [orb776919]
Human
0.16-10 ng/mL
0.059 ng/mL
96 T, 48 T - Item 1 of 1
Human Programmed Cell Death Protein 1 Ligand 1 (PD-L1) ELISA Kit [orb1807270]
Human
0.16-10ng/mL
0.10 ng/mL
48 T, 96 T
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Measured by its binding ability in a functional ELISA. Immobilized PD-L1 at 2 μg/ml can bind Anti- PD-L1 mouse monoclonal antibody, the EC50 of human PD-L1 protein is 1.252-1.653 ng/mL.
The purity of CD274 was greater than 90% as determined by SEC-HPLC.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human CD274 protein (orb605286)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks