You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb245463 |
---|---|
Category | Proteins |
Description | Human CD24 protein |
Tag | N-terminal GST-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 32.3 kDa |
UniProt ID | P25063 |
Protein Sequence | SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | Expression Region: 27-80aa. Protein Length: Full Length of Mature Protein |
Expression Region | 27-80aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | CD 24 protein, CD24 protein, CD-24 protein , CD24 Read more... |
Note | For research use only |
Application notes | This is GST-tag protein |
Expiration Date | 6 months from date of receipt. |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 29.3 kDa after removal of the signal peptide.The apparent molecular mass of CD24-hFc is approximately 35-55 kDa due to glycosylation. | |
Mammalian |
Greater than 95% as determined by SDS-PAGE. | |
25.7 kDa | |
Mammalian cell |
The human CD24 Protein has a MW of 8.1 kDa | |
Mammalian |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 28.8 kDa after removal of the signal peptide. The apparent molecular mass of mCD24-hFc is approximately 35-55 kDa due to glycosylation. | |
Mammalian |
Filter by Rating