You have no items in your shopping cart.
Cart summary
Human CD22 protein
Catalog Number: orb605196
| Catalog Number | orb605196 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human B-cell receptor CD22(CD22),partial |
| Tag | C-terminal 6xHis-tagged |
| Form/Appearance | Lyophilized powder |
| Purity | Greater than 94% as determined by SDS-PAGE. |
| MW | 77.9 kDa |
| UniProt ID | P20273 |
| Protein Sequence | DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRR |
| Protein Length | Partial |
| Source | Mammalian cell |
| Expression System | Expression Region: 20-687aa. Protein Length: Partial |
| Biological Activity | Measured by its binding ability in a functional ELISA. Immobilized CD22 at 2 μg/ml can bind Anti-CD22 rabbit monoclonal antibody, the EC50 of human CD22 protein is 4.034-4.800 ng/ml. |
| Expression Region | 20-687aa |
| Endotoxins | Less than 1.0 EU/ug as determined by LAL method. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
| Alternative names | B-lymphocyte cell adhesion molecule (BL-CAM) (Sial Read more... |
| Note | For research use only |
| Application notes | Extracellular Domain |
| Expiration Date | 6 months from date of receipt. |
Human CD22 Protein, hFc-His Tag [orb689366]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 102.1 kDa after removal of the signal peptide. The apparent molecular mass of CD22-hFc-His is approximately 130-180 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgHuman CD22(417-678) Protein, mFc Tag [orb1826740]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 55.5 kDa after removal of the signal peptide. The apparent molecular mass of CD22(417-678)-mFc is approximately 70-100 kDa due to glycosylation.
Mammalian
100 μg, 50 μg, 10 μgHuman CD22(417-678) Protein, hFc Tag [orb1826741]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 55.4 kDa after removal of the signal peptide. The apparent molecular mass of CD22(417-678)-hFc is approximately 70-100 kDa due to glycosylation.
Mammalian
100 μg, 50 μg, 10 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars