Human CD147 protein

SKU: orb245520

Description

This Human CD147 protein spans the amino acid sequence from region 138-321aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Immunology & Inflammation; Cell Biology

Images & Validation

• Application Notes:
  This is His-tag protein

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 6xHis-tagged
• Expression Region: 138-321aa
• Protein Length: Partial
• MW: 24.2 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

5A11 antigen protein, 5F7 protein, BASI_HUMAN protein, Basigin (Ok blood group) protein, Basigin protein, Blood brain barrier HT7 antigen protein, BSG protein, CD 147 protein, CD147 protein, CD147 antigen protein, Collagenase stimulatory factor protein, Emmprin protein, Extracellular matrix metalloproteinase inducer protein, Leukocyte activation antigen M6 protein, M 6 protein, M6 protein, M6 antigen protein, M6 leukocyte activation antigen protein, Neurothelin protein, OK protein, OK blood group protein, OK blood group antigen protein, TCSF protein, Tumor cell derived collagenase stimulatory factor protein, Tumor cell-derived collagenase stimulatory factor protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P35613