Human CD14 protein

• Catalog Number: orb246916
• Category: Proteins
• Description: Recombinant Human Monocyte differentiation antigen CD14
• Tag: N-terminal 6xHis-Myc-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Purity: Greater than 90% as determined by SDS-PAGE.
• MW: 39.2 kDa
• UniProt ID: P08571
• Protein Sequence: TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMN
• Protein Length: Full Length of Mature Protein
• Source: Mammalian cell
• Expression System: Expression Region: 20-345aa. Protein Length: Full Length of Mature Protein
• Expression Region: 20-345aa
• Endotoxins: Not test.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Alternative names: Myeloid cell-specific leucine-rich glycoprotein, C
• Note: For research use only
• Application notes: Monocyte differentiation antigen CD14, membrane-bound form of HIS and expression region is 20-345aa
• Expiration Date: 6 months from date of receipt.