You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human CD137L protein
Catalog Number: orb245359
| Catalog Number | orb245359 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Tumor necrosis factor ligand superfamily member 9 protein |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 25.3 kDa |
| UniProt ID | P41273 |
| Protein Sequence | PWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
| Protein Length | Partial |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 52-254aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | CD137L, TNFSF9, 4-1BBL Read more... |
| Note | For research use only |
| Application notes | This is His-tag protein |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 2
Human 4-1BB Ligand Protein, mFc-His Tag [orb689407]
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 49.8 kDa after removal of the signal peptide.The apparent molecular mass of mFc-4-1BB Ligand-His is approximately 53-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg - Item 1 of 2
Recombinant human TNFSF9 (Trimer) protein, N-His (HEK293) [orb1516524]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 50-55 kDa based on Tris-Bis PAGE result.
100 μg, 50 μg 
Human 4 1BBL (His) Protein [orb423902]
Greater than 95.0% as determined by SDS-PAGE
Escherichia Coli
1 mg, 5 μg, 20 μgHuman 4 1BBL Protein [orb423901]
Greater than 95.0% as determined by SDS-PAGE.
Escherichia Coli
1 mg, 5 μg, 20 μgRecombinant Human 4-1BBL/TNFSF9/CD137L Protein, His Tag [orb1552989]
≥90% as determined by SDS-PAGE
This protein contains the human TNFSF9(Arg71-Glu254) was fused with the C-terminal His Tag and expressed in E. coli.
100 μg, 50 μg
