You have no items in your shopping cart.
Cart summary
Human CD137L protein
Catalog Number: orb245359
| Catalog Number | orb245359 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Tumor necrosis factor ligand superfamily member 9 protein |
| Tag | N-terminal 6xHis-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 25.3 kDa |
| UniProt ID | P41273 |
| Protein Sequence | PWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE |
| Protein Length | Partial |
| Source | E.coli |
| Expression System | Expression Region: 52-254aa. Protein Length: Partial |
| Expression Region | 52-254aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | CD137L, TNFSF9, 4-1BBL Read more... |
| Note | For research use only |
| Application notes | This is His-tag protein |
| Expiration Date | 6 months from date of receipt. |
Human 4-1BB Ligand Protein, mFc-His Tag [orb689407]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 49.8 kDa after removal of the signal peptide.The apparent molecular mass of mFc-4-1BB Ligand-His is approximately 53-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μgRecombinant Human 4-1BB Ligand/TNFSF9 Protein, Fc His Tag [orb1550325]
> 95% by SDS-PAGE.
KMP2164, Recombinant Human ErbB2/Her2 Protein is produced by mammalian expression system. The target protein is expressed with sequence (Arg71-Glu254 Trimer) of human 4-1BB Ligand/TNFSF9 (Accession #P41273) fused with an Fc tag at the N-terminus.
100 μg, 500 μgRecombinant Human 4-1BBL/TNFSF9/CD137L Protein, His Tag [orb1552989]
≥90% as determined by SDS-PAGE
This protein contains the human TNFSF9(Arg71-Glu254) was fused with the C-terminal His Tag and expressed in E. coli.
100 μg, 50 μgRecombinant Human 4-1BBL/TNFSF9 Protein, Fc Tag [orb1552990]
≥90% as determined by SDS-PAGE
This protein contains the human TNFSF9(Arg71-Glu254) was fused with the N-terminal Fc Tag and expressed in Mammalian cells.
100 μg, 50 μgRecombinant Human 4-1BBL/TNFSF9 Protein, His Tag [orb1553103]
≥90% as determined by SDS-PAGE
This protein contains the human TNFSF9(Ala50-Glu254) was fused with the N-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars