You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb705234 |
---|---|
Category | Proteins |
Description | Recombinant Human C-C motif chemokine 5(CCL5) |
Tag | N-terminal 6xHis-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS |
Protein Length | Full Length of Mature Protein |
UniProt ID | P13501 |
MW | 11.9 kDa |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 24-91aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | EoCPEosinophil chemotactic cytokine;SIS-delta;Smal Read more... |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
> 98% as determined by SDS-PAGE and HPLC. | |
7.8 kDa | |
E.Coli |
> 98 % by SDS-PAGE and HPLC analyses. | |
Approximately 7.8 kDa, a single non-glycosylated polypeptide chain containing 68 amino acids. | |
Escherichia coli |
SDS-PAGE, WB | |
Unconjugated | |
> 85% as determined by SDS-PAGE | |
28 KDa |