You have no items in your shopping cart.
Featured
Description
Research Area
Immunology & Inflammation
Images & Validation
−| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Tag | N-terminal GST-tagged |
| Expression Region | 25-82aa |
| Protein Length | Partial |
| MW | 33.7 kDa |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVP |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−A 152E5.1 protein, ABCD 1 protein, C C motif chemokine 22 protein, CC chemokine STCP 1 protein, CC chemokine STCP-1 protein, ccl 22 protein, Ccl22 protein, CCL22_HUMAN protein, Chemokine (C C motif) ligand 22 protein, DCBCK protein, Macrophage-derived chemokine protein, MDC protein, Small inducible cytokine subfamily A member 22 protein, Small-inducible cytokine A22 protein, STCP 1 protein, Stimulated T cell chemotactic protein 1 protein
Similar Products
−Human Macrophage Derived Chemokine (MDC) ELISA Kit [orb775035]
Human
78.13-5000 pg/mL
29 pg/mL
48 T, 96 THuman CCL22 protein (Active) [orb359079]
> 97% as determined by SDS-PAGE and HPLC.
8.1 kDa
E.Coli
500 μg, 100 μg, 5 μgHuman Macrophage-Derived Chemokine/CCL22 Recombinant Protein [orb1906053]
> 97 % by SDS-PAGE and HPLC analyses.
Approximately 8.1 kDa, a single, non-glycosylated polypeptide chain containing 69 amino acids.
5 μg, 100 μg, 500 μgHuman MDC(Macrophage Derived Chemokine) Microsample ELISA Kit [orb2999094]
Human
78.13-5000 pg/mL
29 pg/mL
48 T, 96 TCCL22/MDC Rabbit Polyclonal Antibody [orb2955926]
ELISA, IHC, WB
Human
Rabbit
Polyclonal
Unconjugated
100 μg, 50 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at support@biorbyt.com.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide





