You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb244803 |
---|---|
Category | Proteins |
Description | Recombinant human C-C motif chemokine 14 |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 24.7 kDa |
UniProt ID | Q16627 |
Protein Sequence | TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | Expression Region: 20-93aa. Protein Length: Full Length of Mature Protein |
Expression Region | 20-93aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | CCL14 Read more... |
Note | For research use only |
Application notes | This is His-SUMO-tag protein |
Expiration Date | 6 months from date of receipt. |
> 96% as determined by SDS-PAGE and HPLC. | |
8.4 kDa | |
E.Coli |
> 95% as determined by SDS-PAGE and HPLC. | |
7.8 kDa | |
E.Coli |
Unconjugated | |
95% | |
10.7 kDa | |
Human CCL14, His Tag (orb1184788) is expressed from human 293 cells (HEK293). It contains AA Thr 20 - Asn 93 (Accession # Q16627-1). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. | |
Human cells |
Unconjugated | |
Greater than 95% as determined by reducing SDS-PAGE. | |
9.71 KDa | |
Mammalian |
Filter by Rating