You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1477766 |
---|---|
Category | Proteins |
Description | Recombinant Human C-C motif chemokine 1(CCL1),Biotinylated |
Tag | N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 56.3 kDa |
UniProt ID | P22362 |
Protein Sequence | KSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKMLRHCPSKRK |
Protein Length | Full Length of Mature Protein |
Source | E.coli |
Expression System | Expression Region: 24-96aa. Protein Length: Full Length of Mature Protein |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | (Small-inducible cytokine A1)(T lymphocyte-secrete Read more... |
Note | For research use only |
Application notes | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Expiration Date | 6 months from date of receipt. |
Biotin | |
● -20°C to -70°C for 12 months in lyophilized state; ● -70°C for 3 months under sterile conditions after reconstitution. For long term storage, the product should be stored at lyophilized state at -20°C or lower. | |
12.1 kDa | |
Biotinylated Human CCL1, His, (orb1184779) is expressed from human 293 cells (HEK293). It contains AA Lys 24 - Lys 96 (Accession # P22362-1). |
Filter by Rating