You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb246668 |
---|---|
Category | Proteins |
Description | Recombinant human Calmodulin-like protein 5 |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | AGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELDAMIREADVDQDGRVNYEEFARMLAQE |
Protein Length | Full Length of Mature Protein |
UniProt ID | Q9NZT1 |
MW | 31.8 kDa |
Application notes | This is His-SUMO-tag protein |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 2-146aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | CALML5 |
Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Human | |
0.16-10 ng/mL | |
0.054 ng/mL |
Human | |
0.156-10ng/mL | |
0.073ng/mL |
> 90% as determined by SDS-PAGE. | |
18.2 kDa |
> 92%, determined by SDS-PAGE | |
This protein contains the human CALML5 (AAH391721) (Met 1-Glu 146) was fused with the N-terminal polyhistidine-tagged GST tag at the N-terminus and expressed from E. coli. |