You have no items in your shopping cart.
Human CA8 protein
SKU: orb594896
Featured
Active
Description
Research Area
Cancer Biology
Images & Validation
−Item 1 of 1
| Application Notes |
|---|
Key Properties
−| Source | E.coli |
|---|---|
| Biological Origin | Homo sapiens (Human) |
| Biological Activity | The esterase activity is determined to be is 162.5 pmol/min/μg. |
| Tag | C-terminal 6xHis-tagged |
| Molecular Weight | 34.04 kDa |
| Expression Region | 2-290aa |
| Protein Length | Partial |
| Protein Sequence | ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxins | Less than 1.0 EU/μg as determined by LAL method. |
Storage & Handling
−| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
|---|---|
| Form/Appearance | Liquid |
| Buffer/Preservatives | 0.2 μm filtered 20 mM Tris-HCl, 500 mM NaCl, 1 mM DTT, pH 8.5 |
| Disclaimer | For research use only |
Alternative Names
−Carbonic Anhydrase-Related Protein; CARP; Carbonic Anhydrase VIII; CA-VIII; CA8; CALS
Similar Products
−
Human Carbonic Anhydrase 8 [orb2993647]
Unconjugated
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE.
Predicted: 34.04 KDa. Observed: 40 KDa, reducing conditions
10 μg, 50 μg, 500 μg, 1 mg- Item 1 of 1
- Item 1 of 1
Human CA8 protein [orb54284]
Greater than 90% as determined by SDS-PAGE.
60 kDa
E.coli
100 μg, 20 μg, 1 mg CA8 (NM_004056) Human Recombinant Protein [orb3047746]
> 80% as determined by SDS-PAGE and Coomassie blue staining
32.8 kDa
20 μg, 100 μg, 1 mgRecombinant Human CA8 Protein, N-His [orb2968668]
>90% as determined by SDS-PAGE.
35.28 kDa
1 mg, 100 μg, 50 μg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Quick Database Links
UniProt
UniProt Details
− No UniProt data available
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human CA8 protein (orb594896)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1-2 weeks