Human CA8 protein

• Catalog Number: orb594896
• Category: Proteins
• Description: Recombinant Human Carbonic anhydrase-related protein(CA8),partial (Active)
• Tag: C-terminal 6xHis-tagged
• Form/Appearance: Liquid
• Buffer/Preservatives: 0.2 μm filtered 20 mM Tris-HCl, 500 mM NaCl, 1 mM DTT, pH 8.5
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: ADLSFIEDTVAFPEKEEDEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREARYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGHEFELYEVRFHWGRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGLKAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYPLTISQLQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
• Protein Length: Partial
• UniProt ID: P35219
• MW: 34.04 kDa
• Application notes: Partial
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Biological Activity: The esterase activity is determined to be is 162.5 pmol/min/μg.
• Expression Region: 2-290aa
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Alternative names: Carbonic Anhydrase-Related Protein; CARP; Carbonic
• Research Area: Cancer Biology
• Note: For research use only
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.