You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human C6orf144 protein
Catalog Number: orb358708
| Catalog Number | orb358708 |
|---|---|
| Category | Proteins |
| Description | Recombinant human C6orf144 protein |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE |
| Protein Length | Extracellular Domain |
| UniProt ID | Q6UXV0 |
| MW | 53.8 kDa |
| Application notes | This is His-SUMO-tag protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 19-351aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | bA360D14.1, C6orf144, GDNF family receptor alpha-l Read more... |
| Note | For research use only |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
- Item 1 of 3
Recombinant human GFRAL protein, C-His-Avi (HEK293) [orb1516445]
> 95% as determined by Tris-Bis PAGE; > 95% as determined by SEC-HPLC
Due to glycosylation, the protein migrates to 48-62 kDa based on Tris-Bis PAGE result.
50 μg - Item 1 of 1
Human GFRAL Protein, His Tag [orb1173843]
The purity of the protein is greater than 85% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 38.6 kDa after removal of the signal peptide. The apparent molecular mass of GFRAL-His is approximately 35-55 kDa due to glycosylation.
Mammalian
10 μg, 100 μg, 50 μg - Item 1 of 1
Human GFRAL protein [orb604993]
Greater than 85% as determined by SDS-PAGE.
42.8 kDa
E.coli
100 μg, 20 μg, 1 mg
