Human C5a protein

SKU: orb358910

Description

This Human C5a protein spans the amino acid sequence from region 678-751aa. Purity: Greater than 90% as determined by SDS-PAGE.

Images & Validation

• Application Notes:
  Partial of HIS-tag and expression region is 16.34kDa

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 6xHis-Myc-tagged
• Molecular Weight: 12.3 kDa
• Expression Region: 678-751aa
• Protein Length: Partial
• Protein Sequence: TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR
• Purity: Greater than 90% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

anaphylatoxin C5a analog protein, Anaphylatoxin C5a protein, C5a anaphylatoxin protein, C5a des Arg protein, Complement C5 alpha chain protein, Complement C5 protein, Complement component C5 protein, Complement component C5a protein, CPAMD4 protein

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P01031