You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb358910 |
---|---|
Category | Proteins |
Description | Recombinant human C5a protein |
Tag | N-terminal 6xHis-Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 12.3 kDa |
UniProt ID | P01031 |
Protein Sequence | TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR |
Protein Length | Partial |
Source | Mammalian cell |
Expression System | Expression Region: 678-751aa. Protein Length: Partial |
Expression Region | 678-751aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | anaphylatoxin C5a analog protein, Anaphylatoxin C5 Read more... |
Note | For research use only |
Application notes | Partial of HIS-tag and expression region is 16.34kDa |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
8.3 kDa | |
Human Complement C5a, Tag Free (orb257232) is expressed from E. coli cells. It contains AA Leu 679 - Arg 751 (Accession # P01031). |
Unconjugated | |
95% | |
10.9 kDa | |
Mouse Complement C5a, His Tag (orb570259) is expressed from E. coli cells. It contains AA Asn 679 - Arg 755 (Accession # P06684). |
Unconjugated | |
95% | |
8.4 kDa | |
Cynomolgus Complement C5a, Tag Free (orb570258) is expressed from E. coli cells. It contains AA Met 678 - Arg 751 (Accession # XP_015292262.1). |
Unconjugated | |
95% | |
10.5 kDa | |
Cynomolgus Complement C5a, His Tag (orb1496181) is expressed from E. coli cells. It contains AA Met 678 - Arg 751 (Accession # XP_015292262.2). |
Unconjugated | |
95% | |
10.2 kDa | |
Human Complement C5a, His Tag (orb1496182) is expressed from E. coli cells. It contains AA Leu 679 - Arg 751 (Accession # P01031-1). |
Filter by Rating