You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb358075 |
---|---|
Category | Proteins |
Description | Recombinant human C5 protein |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQLRANISHKDMQLGR |
Protein Length | Partial |
UniProt ID | P01031 |
MW | 24.3 kDa |
Application notes | Full length of C5a anaphylatoxin chain of His-SUMO-tag and expression region is 678-751aa |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 678-751aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | C3 and PZP-like alpha-2-macroglobulin domain-conta Read more... |
Research Area | Signal Transduction |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Greater than 90% as determined by SDS-PAGE. | |
70.9 kDa | |
E.coli |
Unconjugated | |
90% | |
73.9 kDa (β chain) & 114.4 kDa (α chain) |
Unconjugated | |
95% | |
73.5 kDa (β chain) & 114.6 kDa (α chain) |