You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb246884 |
---|---|
Category | Proteins |
Description | Recombinant human Butyrophilin subfamily 3 member A1 |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 40.2 kDa |
UniProt ID | O00481 |
Protein Sequence | QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAG |
Protein Length | Extracellular Domain |
Source | E.coli |
Expression System | Expression Region: 30-254aa. Protein Length: Extracellular Domain |
Expression Region | 30-254aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | BTN3A1 Read more... |
Note | For research use only |
Application notes | Full length of Extracellular of His-SUMO-tag and expression region is 30-254aa |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
50.8 kDa | |
Human BTN3A1, Fc Tag (orb383498) is expressed from human 293 cells (HEK293). It contains AA Gln 30 - Gly 254 (Accession # AAI21801). |
Greater than 90% as determined by SDS-PAGE. | |
26.2 kDa | |
Yeast |
Unconjugated | |
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining. | |
The protein has a predicted molecular mass of 51.36 kDa after removal of the signal peptide. | |
Mammalian |
Greater than 90% as determined by SDS-PAGE. | |
30.2 kDa | |
E.coli |
Filter by Rating