Human BSG protein

SKU: orb605194

Description

This Human BSG protein spans the amino acid sequence from region 138-323aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Cancer Biology

Images & Validation

• Application Notes:
  Partial

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Tag: C-terminal hFc1-tagged
• Molecular Weight: 49.3 kDa
• Expression Region: 138-323aa
• Protein Length: Partial
• Protein Sequence: EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHLA
• Purity: Greater than 85% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

5A11 antigen, 5F7, BASI_HUMAN, Basigin (Ok blood group), Basigin, Blood brain barrier HT7 antigen, Bsg, CD 147, CD147, CD147 antigen, Collagenase stimulatory factor, EMMPRIN, Extracellular matrix metalloproteinase inducer, Leukocyte activation antigen M6, M 6, M6, M6 leukocyte activation antigen, Neurothelin, OK, OK blood group, OK blood group antigen, TCSF, Tumor cell derived collagenase stimulatory factor, Tumor cell-derived collagenase stimulatory factor

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P35613