Human BRCC3 protein

• Catalog Number: orb418706
• Category: Proteins
• Description: Recombinant Human Lys-63-specific deubiquitinase BRCC36
• Tag: N-terminal 6xHis-GST-tagged
• Form/Appearance: Liquid or Lyophilized powder
• Purity: Greater than 90% as determined by SDS-PAGE.
• MW: 65.9 kDa
• UniProt ID: P46736
• Protein Sequence: AVQVVQAVQAVHLESDAFLVCLNHALSTEKEEVMGLCIGELNDDTRSDSKFAYTGTEMRTVAEKVDAVRIVHIHSVIILRRSDKRKDRVEISPEQLSAASTEAERLAELTGRPMRVVGWYHSHPHITVWPSHVDVRTQAMYQMMDQGFVGLIFSCFIEDKNTKTGRVLYTCFQSIQAQKSSESLHGPRDFWSSSQHISIEGQKEEERYERIEIPIHIVPHVTIGKVCLESAVELPKILCQEEQDAYRRIHSLTHLDSVTKIHNGSVFTKNLCSQMSAVSGPLLQWLEDRLEQNQQHLQELQQEKEELMQELSSLE
• Protein Length: Full Length of Mature Protein
• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Expression Region: 2-316aa
• Endotoxins: Not test.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Alternative names: BR, CA1-A complex subunit BR, CC36BR, CA1/BR, CA2-
• Note: For research use only
• Application notes: Tag Info: N-terminal 6xHis-GST-tagged Expression Region: 2-316aaSequence Info: Full Length
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.