You have no items in your shopping cart.
Cart summary
Human BMPR1A protein
Catalog Number: orb246303
| Catalog Number | orb246303 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Bone morphogenetic protein receptor type-1A |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 56.6 kDa |
| UniProt ID | P36894 |
| Protein Sequence | KHYCKSISSRRRYNRDLEQDEAFIPVGESLKDLIDQSQSSGSGSGLPLLVQRTIAKQIQMVRQVGKGRYGEVWMGKWRGEKVAVKVFFTTEEASWFRETEIYQTVLMRHENILGFIAADIKGTGSWTQLYLITDYHENGSLYDFLKCATLDTRALLKLAYSAACGLCHLHTEIYGTQGKPAIAHRDLKSKNILIKKNGSCCIADLGLAVKFNSDTNEVDVPLNTRVGTKRYMAPEVLDESLNKNHFQPYIMADIYSFGLIIWEMARRCITGGIVEEYQLPYYNMVPSDPSYEDMREVVCVKRLRPIVSNRWNSDECLRAVLKLMSECWAHNPASRLTALRIKKTLAKMVESQDVKI |
| Protein Length | Cytoplasmic Domain |
| Source | E.coli |
| Expression System | Expression Region: 177-532aa. Protein Length: Cytoplasmic Domain |
| Expression Region | 177-532aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | BMPR1A Read more... |
| Note | For research use only |
| Application notes | Full length of Cytoplasmic of His-SUMO-tag and expression region is 177-532aa |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human BMPR-1A / ALK-3 Protein [orb257183]
Unconjugated
98%
40.3 kDa
Human BMPR-1A, Fc Tag (orb257183) is expressed from human 293 cells (HEK293). It contains AA Gln 24 - Arg 152 (Accession # P36894-1).
1 mg, 200 μg Human BMPR1A protein [orb391302]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman BMPR1A ELISA Kit [orb406354]
Human
0.312 ng/mL-20 ng/mL
0.078 ng/mL
10 x 96 t, 5 x 96 t, 96 t, 48 t, 24THuman BMPR1A Protein, hFc Tag [orb1743342]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 40.3 kDa after removal of the signal peptide. The apparent molecular mass of BMPR1A-hFc is approximately 35-70 kDa due to glycosylation.
Mammalian
10 μg, 50 μg, 100 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars