Human BMP 7 Protein

SKU: orb424350

Description

Recombinant of human,plant BMP 7 protein

Images & Validation

• Application Notes:
  Cytokines And Growth Factors

Key Properties

• Source: Nicotiana benthamiana
• Biological Activity: The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg.
• Purity: Greater than 97.0% as determined by SDS-PAGE.
• Protein Sequence: HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH

Storage & Handling

• Storage: Stability: Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Buffer/Preservatives: BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Osteogenic Protein 1, BMP-7.