Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human BMP 7 protein
Catalog Number orb424350
ReactivityHuman, Plant
ConjugationUnconjugated
Target BMP 7
Product Properties
Form/Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4.
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Note For research use only.
Protein Sequence HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH.
Purity >97.0% as determined by SDS-PAGE.
Source Nicotiana benthamiana.
Activity The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg.
Product Description

Recombinant of human,plant BMP 7 protein

Solubility (25°C)
Solubility (25°C) Lyophilized BMP-7 protein should be reconstituted in distilled water to a concentration of 50 ng/μl.
Reviews
Write Your Own Review
You're reviewing:Human BMP 7 protein - orb424350
Your Rating