You have no items in your shopping cart.
Human BMP 7 Protein
SKU: orb424350
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Nicotiana benthamiana |
|---|---|
| Biological Activity | The biological activity of BMP-7 was measured by its ability to induce alkaline phosphatase production by ATDC5 cells, ED50 is less than 40ng/ml, corresponding to a specific activity of 25,000 units/mg. |
| Protein Sequence | HHHHHHSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSVILKKYRNMVVRACGCH |
| Purity | Greater than 97.0% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized BMP-7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP 7 Human should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | BMP-7 was lyophilized from a solution containing Tris-HCl 0.05M buffer at pH 7.4. |
| Disclaimer | For research use only |
Alternative Names
−Osteogenic Protein 1, BMP-7.
Similar Products
−Human Bone Morphogenetic Protein 7 (BMP-7) ELISA Kit [orb1807656]
Human
31.25-2000pg/mL
13.7 pg/mL
48 T, 96 TBMP7 Antibody [orb213608]
IHC, WB
Canine, Gallus, Human, Monkey, Mouse, Porcine, Rabbit, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 30 μl, 100 μl, 200 μlRecombinant human BMP-7 protein, His [orb86212]
>95% as determined by SDS-PAGE
23-25 kDa
100 μg, 500 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human BMP 7 Protein (orb424350)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review








