Cart summary

You have no items in your shopping cart.

Human BMP 7 (HEK) Protein

SKU: orb424348

Description

Recombinant of human BMP 7 (HEK) protein

Images & Validation

Application Notes
Cytokines And Growth Factors

Key Properties

SourceHEK
Biological ActivityThe specific activity was determined by the dose dependent induction of alkaline phosphatase production in the ATDC-5 cell line (Mouse chondrogenic cell line) and is typically 50-250ng/ml.
Protein SequenceDFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAM AVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPR YHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQEHLGRESDLFLDSRTLWASE EGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKAT
PurityGreater than 95% as obsereved by SDS-PAGE.

Storage & Handling

StorageStability: Lyophilized BMP7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP-7 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
Buffer/PreservativesThe BMP7 was lyophilized from 1mg/ml in 1xPBS.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

Osteogenic Protein 1, BMP-7.
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Human BMP 7 (HEK) Protein (orb424348)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

1 μg
$ 250.00
5 μg
$ 350.00
50 μg
$ 1,570.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry