Human BMP 7 (HEK) Protein

SKU: orb424348

Description

Recombinant of human BMP 7 (HEK) protein

Images & Validation

• Application Notes:
  Cytokines And Growth Factors

Key Properties

• Source: HEK
• Biological Activity: The specific activity was determined by the dose dependent induction of alkaline phosphatase production in the ATDC-5 cell line (Mouse chondrogenic cell line) and is typically 50-250ng/ml.
• Protein Sequence: DFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRPHLQGKHNSAPMFMLDLYNAM AVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLVEHDKEFFHPR YHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQEHLGRESDLFLDSRTLWASE EGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKAT
• Purity: Greater than 95% as obsereved by SDS-PAGE.

Storage & Handling

• Storage: Stability: Lyophilized BMP7 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP-7 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles
• Form/Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
• Buffer/Preservatives: The BMP7 was lyophilized from 1mg/ml in 1xPBS.
• Disclaimer: For research use only

Alternative Names

Osteogenic Protein 1, BMP-7.