You have no items in your shopping cart.
Cart summary
Human BGN protein
Catalog Number: orb419048
| Catalog Number | orb419048 |
|---|---|
| Category | Proteins |
| Description | Recombinant Human Biglycan |
| Tag | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 57.2 kDa |
| UniProt ID | P21810 |
| Protein Sequence | DEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKK |
| Protein Length | Full Length of Mature Protein |
| Source | E.coli |
| Expression System | Expression Region: 38-368aa. Protein Length: Full Length of Mature Protein |
| Expression Region | 38-368aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Bone/cartilage proteoglycan I PG-S1 Read more... |
| Note | For research use only |
| Application notes | Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-taggedExpression Region: 38-368aaSequence Info: Full Length of Mature Protein |
| Expiration Date | 6 months from date of receipt. |
Human BGN protein [orb391294]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman BGN ELISA Kit [orb404036]
Human
0.312 ng/mL-20 ng/mL
0.078 ng/mL
48 t, 10 x 96 t, 5 x 96 t, 96 t, 24T- Item 1 of 1
Recombinant Human Biglycan/BGN Protein, His Tag [orb1552839]
≥90% as determined by SDS-PAGE
This protein contains the human BGN(Glu20-Lys368) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars