You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb244882 |
|---|---|
| Category | Proteins |
| Description | Recombinant human Bcl-2-like protein 2 |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETQLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVALGALVTVGAFFASK |
| Protein Length | Full Length of Mature Protein |
| UniProt ID | Q92843 |
| MW | 36.6 kDa |
| Application notes | This is His-SUMO-tag protein |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 2-193aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | BCL2L2 |
| Research Area | Cancer Biology |
| Note | For research use only |

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Unconjugated | |
SDS-PAGE: Greater than 95% as determined by reducing SDS-PAGE. | |
Predicted: 19.87 KDa. Observed: 18 KDa, reducing conditions |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review