Availability

  • Request Lead Time
  • In stock and ready for quick dispatch
  • Usually dispatched within 5-10 working days
Shipping Destination:
United States
Shipping charges:
Freight/Packing: $34.00

Need Help?

Ask a Question Support@biorbyt.com
Product Overview
Product Name Human BAFF R protein
Catalog Number orb424250
ReactivityHuman
ConjugationUnconjugated
Target BAFF R
Product Properties
Form/Appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Lyophilized from a 0.2μm filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl.
Storage Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles.
Note For research use only.
Protein Sequence MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG.
Purity >95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Source Escherichia Coli.
Activity Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1.0-5.0 μg/ml in the presence of 1.0μg/ml of human soluble BAFF.
Product Description

Recombinant of human BAFF R protein

Solubility (25°C)
Solubility (25°C) It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions.
Reviews
Write Your Own Review
You're reviewing:Human BAFF R protein - orb424250
Your Rating