You have no items in your shopping cart.
Human BAFF R Protein
SKU: orb424250
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Biological Activity | Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1.0-5.0 µg/ml in the presence of 1.0µg/ml of human soluble BAFF. |
| Protein Sequence | MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAGASSPAPRTALQPQESVGAGAGEAALPLPG |
| Purity | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4°C between 2-7 days and for future use below -18°C.Please prevent freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Buffer/Preservatives | Lyophilized from a 0.2μm filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl. |
| Disclaimer | For research use only |
Alternative Names
−TNFRSF13C, CD268, BAFF-R, MGC138235, B cell-activating factor receptor.
Similar Products
−- Item 1 of 4
Human BAFF-R Protein, mFc Tag [orb689403]
Unconjugated
The purity of the protein is greater than 95% as determined by SDS-PAGE and Coomassie blue staining.
The protein has a predicted molecular mass of 33.6 kDa after removal of the signal peptide.The apparent molecular mass of BAFF-R-mFc is approximately 35-55 kDa due to glycosylation.
Mammalian
50 μg, 100 μg, 10 μg Recombinant Human CD268/TNFRSF13C Protein, C-Fc [orb2967451]
>90% as determined by SDS-PAGE.
35.79 kDa
1 mg, 100 μg, 50 μgRecombinant Human CD268/TNFRSF13C Protein, N-His [orb2967452]
>90% as determined by SDS-PAGE.
11.55 kDa
1 mg, 100 μg, 50 μg- Item 1 of 1
Human TR13C protein (Active) [orb359195]
> 95% as determined by SDS-PAGE.
7.8 kDa
E.Coli
10 μg, 100 μg, 500 μg Human BAFF-R protein [orb755852]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
8.3 kDa
E.Coli
50 μg, 200 μg, 100 μg, 1 mg
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Human BAFF R Protein (orb424250)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days