You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb594954 |
---|---|
Category | Proteins |
Description | Recombinant Human AT-rich interactive domain-containing protein 1A(ARID1A),partial |
Tag | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 85% as determined by SDS-PAGE. |
MW | 32.4 kDa |
UniProt ID | O14497 |
Protein Sequence | SLAKRCVCVSNTIRSLSFVPGNDFEMSKHPGLLLILGKLILLHHKHPERKQAPLTYEKEEEQDQGVSCNKVEWWWDCLEMLRENTLVTLANISGQLDLSPYPESICLPVLDGLLHWAVCPSAEAQDPFSTLGPNAVLSPQRLVLETLSKLSIQDNNVDLILATPPFSRLEKLYSTMVRFLSDRKNPVCREMAVVLLANLAQGDSLAARAIAVQKGSIGNLLGFLEDSLAATQFQQSQASLLHMQNPPFEPTSVDMM |
Protein Length | Partial |
Source | Baculovirus |
Expression System | Expression Region: 1976-2231aa. Protein Length: Partial |
Expression Region | 1976-2231aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | B120 BRG1-associated factor 250 Short name, BAF250 Read more... |
Note | For research use only |
Application notes | Partial |
Expiration Date | 6 months from date of receipt. |
Greater than 85% as determined by SDS-PAGE. | |
33.4 kDa | |
E.coli |
Human | |
12.5-800ng/L | |
6.61ng/L |
Human | |
15-3000ng/L | |
7.89ng/L |
Filter by Rating