You have no items in your shopping cart.
Cart summary
Human ARG1 protein
Catalog Number: orb54215
| Catalog Number | orb54215 |
|---|---|
| Category | Proteins |
| Description | Recombinant human ARG1 protein |
| Tag | N-terminal GST-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 61.7 kDa |
| UniProt ID | P05089 |
| Protein Sequence | MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK |
| Protein Length | Full Length |
| Source | E.coli |
| Expression System | Expression Region: 1-322aa. Protein Length: Full Length |
| Expression Region | 1-322aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Liver-type arginase Type I arginase Read more... |
| Note | For research use only |
| Application notes | N-terminal 6xHis-tagged: N-terminal GST-tagged1747-1905AA: 1-322AACytoplasmic Domain: Full Length |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human Arginase 1 / ARG1 Protein [orb257193]
Unconjugated
95%
35.8 kDa
Human Arginase 1, His Tag (orb257193) is expressed from human 293 cells (HEK293). It contains AA Met 1 - Lys 322 (Accession # NP_000036).
1 mg, 50 μg Human ARG1 protein [orb706809]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgHuman ARG1 protein [orb391255]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
E. coli
500 μg, 50 μg, 10 μgRecombinant Human Arginase-1/ARG1 Protein, His Tag [orb1552904]
≥90% as determined by SDS-PAGE
This protein contains the human ARG1(Met1-lys322) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μgRecombinant Human Arginase-1/ARG1 Protein, His Tag [orb1552905]
≥90% as determined by SDS-PAGE
This protein contains the human ARG1(Met1-lys322) was fused with the C-terminal His Tag and expressed in E. coli.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars