You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb54039 |
---|---|
Category | Proteins |
Description | Human Angiotensinogen protein |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Purity | Greater than 90% as determined by SDS-PAGE. |
MW | 57.9 kDa |
UniProt ID | P01019 |
Protein Sequence | VIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNS |
Protein Length | Partial |
Source | E.coli |
Expression System | Expression Region: 44-427aa. Protein Length: Partial |
Expression Region | 44-427aa |
Endotoxins | Not test. |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Alternative names | Aangiotensinogen (serpin peptidase inhibitor clade Read more... |
Note | For research use only |
Application notes | Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 44-427AASequence Info: Partial |
Expiration Date | 6 months from date of receipt. |
Unconjugated | |
95% | |
43.1 kDa | |
Human RENIN, His Tag (orb257792) is expressed from human 293 cells (HEK293). It contains AA Leu 24 - Arg 406 (Accession # P00797-1). |
ELISA, MS, SDS-PAGE, WB | |
Greater than 95% as determined by reducing SDS-PAGE. | |
Human cells |
≥90% as determined by SDS-PAGE | |
This protein contains the human AGT(Asp34-Ala485) was fused with the C-terminal His Tag and expressed in Mammalian cells. |
> 97% by SDS-PAGE. | |
KMP1417, Recombinant Human Angiotensinogen Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Asp 34 - Ala 485 ) of human Angiotensinogen (Accession #NP_000020.1) fused with a 6×His Tag at the C-terminus. |
Filter by Rating