You have no items in your shopping cart.
Cart summary
Human Angiotensinogen protein
Catalog Number: orb54039
| Catalog Number | orb54039 |
|---|---|
| Category | Proteins |
| Description | Human Angiotensinogen protein |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| MW | 57.9 kDa |
| UniProt ID | P01019 |
| Protein Sequence | VIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNS |
| Protein Length | Partial |
| Source | E.coli |
| Expression System | Expression Region: 44-427aa. Protein Length: Partial |
| Expression Region | 44-427aa |
| Endotoxins | Not test. |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Alternative names | Aangiotensinogen (serpin peptidase inhibitor clade Read more... |
| Note | For research use only |
| Application notes | Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 44-427AASequence Info: Partial |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Human RENIN Protein [orb257792]
Unconjugated
95%
43.1 kDa
Human RENIN, His Tag (orb257792) is expressed from human 293 cells (HEK293). It contains AA Leu 24 - Arg 406 (Accession # P00797-1).
1 mg, 100 μg Human Angiotensin II protein [orb707048]
ELISA, MS, SDS-PAGE, WB
Greater than 95% as determined by reducing SDS-PAGE.
Human cells
500 μg, 50 μg, 10 μgRecombinant Human AGT Protein, His Tag [orb1552956]
≥90% as determined by SDS-PAGE
This protein contains the human AGT(Asp34-Ala485) was fused with the C-terminal His Tag and expressed in Mammalian cells.
100 μg, 50 μgRecombinant Human Angiotensinogen Protein, His Tag [orb1551070]
> 97% by SDS-PAGE.
KMP1417, Recombinant Human Angiotensinogen Protein is produced by HEK293 Cells expression system. The target protein is expressed with sequence (Asp 34 - Ala 485 ) of human Angiotensinogen (Accession #NP_000020.1) fused with a 6×His Tag at the C-terminus.
100 μg, 50 μg
Submit a review
Filter by Rating
- 5 stars
- 4 stars
- 3 stars
- 2 stars
- 1 stars