Human Angiotensinogen protein

SKU: orb54039

Description

This Human Angiotensinogen protein spans the amino acid sequence from region 44-427aa. Purity: Greater than 90% as determined by SDS-PAGE.

Research Area

Cardiovascular Research

Images & Validation

• Application Notes:
  Tag Info: N-terminal 6xHis-SUMO-taggedExpression Region: 44-427AASequence Info: Partial

Key Properties

• Source: E.coli
• Biological Origin: Homo sapiens (Human)
• Tag: N-terminal 6xHis-SUMO-tagged
• Molecular Weight: 57.9 kDa
• Expression Region: 44-427aa
• Protein Length: Partial
• Protein Sequence: VIHNESTCEQLAKANAGKPKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLDFTELDVAAEKIDRFMQAVTGWKTGCSLMGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEFWVDNSTSVSVPMLSGMGTFQHWSDIQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLTFQQNSLNWMKKLSPRTIHLTMPQLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRIRVGEVLNS
• Purity: Greater than 90% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Liquid or Lyophilized powder
• Buffer/Preservatives: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Disclaimer: For research use only

Alternative Names

Aangiotensinogen (serpin peptidase inhibitor clade A member 8) Proteins, AGT Proteins, AI265500 Proteins, Alpha 1 antiproteinase antitrypsin Proteins, Ang Proteins, Ang I Proteins, Ang II Proteins, Ang III Proteins, AngII Proteins, Angiotensin I Proteins, Angiotensin II Proteins, Angiotensin III Proteins, Angiotensin-3 Proteins, Angiotensinogen (PAT) Proteins, Angiotensinogen Proteins, ANGT_HUMAN Proteins, ANHU Proteins, ANRT Proteins, AT-2 Proteins, AT-II Proteins, Des-Asp[1]-angiotensin II Proteins, FLJ92595 Proteins, FLJ97926 Proteins, MGC105326 Proteins, PAT Proteins, Pre angiotensinogen Proteins, Serine (or cysteine) proteinase inhibitor Proteins, Serpin A8 Proteins, Serpin peptidase inhibitor clade A member 8 Proteins, SERPINA8 Proteins

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Quick Database Links

UniProt

P01019