Human ACVR2B protein

• Catalog Number: orb594924
• Category: Proteins
• Description: Recombinant Human Activin receptor type-2B(ACVR2B),partial (Active)
• Tag: C-terminal 6xHis-Fc-tagged
• Form/Appearance: Lyophilized powder
• Purity: Greater than 95% as determined by SDS-PAGE.
• MW: 41.3 kDa
• UniProt ID: Q13705
• Protein Sequence: SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT
• Protein Length: Partial
• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human Activin A at 2μg/ml can bind Human ACVR2B-Fc-His, the ED50 of Recombinant Human ACVR2B-Fc-His is 50-500 ng/ml.
• Expression Region: 19-134aa
• Endotoxins: Less than 1.0 EU/µg as determined by LAL method.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 10% Trehalose, 3% Mannitol, 0.05% Tween 80, 10 mM Methionine, pH 8.5.
• Alternative names: Activin Receptor Type-2B; Activin Receptor Type II
• Note: For research use only
• Application notes: Partial
• Expiration Date: 6 months from date of receipt.

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.