Human ACVR2B protein

Catalog Number: orb594924

Catalog Number	orb594924
Category	Proteins
Description	Recombinant Human Activin receptor type-2B(ACVR2B),partial (Active)
Tag	C-terminal 6xHis-Fc-tagged
Form/Appearance	Lyophilized powder
Purity	Greater than 95% as determined by SDS-PAGE.
MW	41.3 kDa
UniProt ID	Q13705
Protein Sequence	SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT
Protein Length	Partial
Source	Mammalian cell
Expression System	Expression Region: 19-134aa. Protein Length: Partial
Biological Activity	The ED50 as determined by its ability to bind Human Activin A in functional ELISA is less than 100 ng/ml.
Expression Region	19-134aa
Endotoxins	Less than 1.0 EU/µg as determined by LAL method.
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Buffer/Preservatives	Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alternative names	Activin Receptor Type-2B; Activin Receptor Type II Read more...
Note	For research use only
Application notes	Partial
Expiration Date	6 months from date of receipt.

Purity:	Greater than 85% as determined by SDS-PAGE.
MW:	27.7 kDa
Source:	E.coli

Purity:	Greater than 90% as determined by SDS-PAGE.
MW:	15.7 kDa
Source:	Yeast

Applications:	ELISA, MS, SDS-PAGE, WB
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Source:	Human cells

Conjugation:	Unconjugated
Purity:	90%
MW:	14.5 kDa
Source:	Human Activin RIIB, His Tag (orb257168) is expressed from human 293 cells (HEK293). It contains AA Ser 19 - Thr 137 (Accession # Q13705-1).