Human ACVR2B protein

SKU: orb594924

Description

This Human ACVR2B protein spans the amino acid sequence from region 19-134aa. Purity: Greater than 95% as determined by SDS-PAGE.

Research Area

Signal Transduction

Images & Validation

• Application Notes:
  Partial

Key Properties

• Source: Mammalian cell
• Biological Origin: Homo sapiens (Human)
• Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human Activin A at 2μg/ml can bind Human ACVR2B-Fc-His, the ED50 of Recombinant Human ACVR2B-Fc-His is 50-500 ng/ml.
• Tag: C-terminal 6xHis-Fc-tagged
• Expression Region: 19-134aa
• Protein Length: Partial
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.
• MW: 41.3 kDa
• Purity: Greater than 95% as determined by SDS-PAGE.
• Protein Sequence: SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 10% Trehalose, 3% Mannitol, 0.05% Tween 80, 10 mM Methionine, pH 8.5.
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Activin Receptor Type-2B; Activin Receptor Type IIB; ACTR-IIB; ACVR2B

Quick Database Links

UniProt

Q13705