You have no items in your shopping cart.
Cart summary
Item 1 of 1
Human ACLY protein
Catalog Number: orb358644
| Catalog Number | orb358644 |
|---|---|
| Category | Proteins |
| Description | Recombinant human ACLY protein |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Form/Appearance | Liquid or Lyophilized powder |
| Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Protein Sequence | KAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLK |
| Protein Length | Partial |
| UniProt ID | P53396 |
| MW | 45.5 kDa |
| Application notes | This is His-SUMO-tag protein |
| Endotoxins | Not test. |
| Source | E.coli |
| Biological Origin | Homo sapiens (Human) |
| Expression Region | 4-265aa |
| Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
| Alternative names | ATP-citrate (pro-S-)-lyase Short name, ACL Citrate Read more... |
| Research Area | Metabolism Research |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Human ATP citrate lyase protein [orb754746]
ELISA, WB
Greater than 95% as determined by SDS-PAGE
28.7 kDa
E.Coli
200 μg, 100 μg, 50 μg, 1 mgATP citrate lyase/ACLY Protein, Human, Recombinant (His) [orb1957197]
96.00%
123 kDa (predicted); 110 kDa (reducing conditions)
50 μg, 100 μg, 200 μg, 500 μgHuman ACLY Protein, His Tag [orb2700605]
>90%, determined by SDS-PAGE
This protein contains the human ACLY (P53396) (Met 1-Met 1101) was expressed with a polyhistidine tag at the N-terminus and expressed from Baculovirus-Insect Cells.
10 μg, 5 μgRecombinant Human ACLY Protein, N-His [orb2832209]
>90% as determined by SDS-PAGE.
68 kDa
100 μg, 20 μg, 50 μgRecombinant Human ACLY Protein, N-His [orb2962665]
>90% as determined by SDS-PAGE.
68.00 kDa
1 mg, 100 μg, 50 μg
