You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb358644 |
---|---|
Category | Proteins |
Description | Recombinant human ACLY protein |
Tag | N-terminal 6xHis-SUMO-tagged |
Form/Appearance | Liquid or Lyophilized powder |
Buffer/Preservatives | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Protein Sequence | KAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKPRLGQEATVGKATGFLKNFLIEPFVPHSQAEEFYVCIYATREGDYVLFHHEGGVDVGDVDAKAQKLLVGVDEKLNPEDIKKHLLVHAPEDKKEILASFISGLFNFYEDLYFTYLEINPLVVTKDGVYVLDLAAKVDATADYICKVKWGDIEFPPPFGREAYPEEAYIADLDAKSGASLK |
Protein Length | Partial |
UniProt ID | P53396 |
MW | 45.5 kDa |
Application notes | This is His-SUMO-tag protein |
Endotoxins | Not test. |
Source | E.coli |
Biological Origin | Homo sapiens (Human) |
Expression Region | 4-265aa |
Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. |
Alternative names | ATP-citrate (pro-S-)-lyase Short name, ACL Citrate Read more... |
Research Area | Metabolism Research |
Note | For research use only |
Expiration Date | 6 months from date of receipt. |
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
ELISA, WB | |
Greater than 95% as determined by SDS-PAGE | |
28.7 kDa | |
E.Coli |
96.00% | |
123 kDa (predicted); 110 kDa (reducing conditions) |
>90%, determined by SDS-PAGE | |
This protein contains the human ACLY (P53396) (Met 1-Met 1101) was expressed with a polyhistidine tag at the N-terminus and expressed from Baculovirus-Insect Cells. |
>90% as determined by SDS-PAGE. | |
68 kDa |
>90% as determined by SDS-PAGE. | |
68.00 kDa |