Human 2019-nCOV-S protein

SKU: orb638762

Description

This Human 2019-nCOV-S protein spans the amino acid sequence from region 16-685aa. Purity: Greater than 85% as determined by SDS-PAGE.

Research Area

Microbiology

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: Mammalian cell
• Biological Origin: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2)
• Biological Activity: ①Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 μg/ml can bind human ACE2, the EC50 of SARS-CoV-2-S protein is 56.64 - 103.6 ng/ml. ②Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 μg/ml can bind SARS-CoV-2-S Antibody, the EC50 of SARS-CoV-2-S protein is 36.79-48.87 ng/ml.
• Tag: N-terminal 10xHis-tagged and C-terminal Flag-tagged
• Molecular Weight: 79.6 kDa
• Expression Region: 16-685aa
• Protein Length: Partial
• Protein Sequence: VNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHSTQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNIIRGWIFGTTLDSKTQSLLIVNNATNVVIKVCEFQFCNDPFLGVYYHKNNKSWMESEFRVYSSANNCTFEYVSQPFLMDLEGKQGNFKNLREFVFKNIDGYFKIYSKHTPINLVRDLPQGFSALEPLVDLPIGINITRFQTLLALHRSYLTPGDSSSGWTAGAAAYYVGYLQPRTFLLKYNENGTITDAVDCALDPLSETKCTLKSFTVEKGIYQTSNFRVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFNFNGLTGTGVLTESNKKFLPFQQFGRDIADTTDAVRDPQTLEILDITPCSFGGVSVITPGTNTSNQVAVLYQDVNCTEVPVAIHADQLTPTWRVYSTGSNVFQTRAGCLIGAEHVNNSYECDIPIGAGICASYQTQTNSPRRAR
• Purity: Greater than 85% as determined by SDS-PAGE.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Expiration Date: 6 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

/

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 μg/ml can bind human ACE2, the EC50 of SARS-CoV-2-S protein is 56.64 - 103.6 ng/ml.

Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S at 2 μg/ml can bind SARS-CoV-2-S Antibody, the EC50 of SARS-CoV-2-S protein is 36.79-48.87 ng/ml

Quick Database Links

UniProt

P0DTC2