HTR1A Rabbit Polyclonal Antibody

• Catalog Number: orb592792
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HTR1A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HTR1A
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 46kDa
• Target: HTR1A
• UniProt ID: P08908
• Protein Sequence: Synthetic peptide located within the following region: GQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNAC
• NCBI: NP_000515
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: G-21, 5HT1a, PFMCD, 5-HT1A, 5-HT-1A, ADRBRL1, ADRB
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-HTR1A Antibody Titration: 0.0625 ug/ml, ELISA Titer: 1:62500, Positive Control: Jurkat cell lysate.