You have no items in your shopping cart.
HSV-2 gB Protein
SKU: orb260183
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH |
| Purity | Protein is >90% pure as determined by SDS PAGE. |
Storage & Handling
−| Storage | Stability: HSV-2 gB although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles |
|---|---|
| Form/Appearance | Sterile Filtered clear solution. |
| Buffer/Preservatives | 10mM Phosphate buffer pH 7.6 and 75mM NaCl. |
| Disclaimer | For research use only |
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
HSV-2 gB Protein (orb260183)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 5-10 working days