Cart summary

You have no items in your shopping cart.

HS747E2A Rabbit Polyclonal Antibody (Biotin)

HS747E2A Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2134304

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2134304
CategoryAntibodies
DescriptionHS747E2A Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Human, Porcine
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human HS747E2A
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW33kDa
UniProt IDO95567
Protein SequenceSynthetic peptide located within the following region: MKATQQARKRNFISSKSKQPAGHRRPAGGIRESKESSKEKKLTVRQDLED
NCBINP_056185
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesHS747E2A, bK747E2.1
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.