Horse IL1RA protein (Active)

SKU: orb359025

Description

This Horse IL1RA protein (Active) spans the amino acid sequence from region 26-177aa. Purity: > 95% as determined by SDS-PAGE and HPLC.

Images & Validation

• Application Notes:
  We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Key Properties

• Source: E.Coli
• Biological Origin: Equus caballus (Horse)
• Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by inhibiting IL-1α- dependent proliferation of murine D10S cells is less than 3.0 μg/ml, corresponding to a specific activity of ＞ 333 IU/mg in the presence of 50 pg/ml rHuIL-1α.
• Tag: Tag-Free
• Molecular Weight: 17.4 kDa
• Expression Region: 26-177aa
• Protein Length: Full Length of Mature Protein
• Protein Sequence: HPLGKRPCKMQAFRIWDVNQKTFYMRNNQLVAGYLQESNTKLQEKIDVVPIEPDALFLGLHGRKLCLACVKSGDEIRFQLEAVNITDLSKNKEENKRFTFIRSNSGPTTSFESAACPGWFLCTAQEADRPVSLTNKPKESFMVTKFYLQEDQ
• Purity: > 95% as determined by SDS-PAGE and HPLC.
• Endotoxins: Less than 1.0 EU/μg as determined by LAL method.

Storage & Handling

• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized from a 0.2 µm filtered PBS, pH 7.4
• Disclaimer: For research use only

Alternative Names

DIRA protein, ICIL 1RA protein, ICIL-1RA protein, ICIL1RA protein, IL-1ra protein, IL-1ra3 protein, IL-1RN protein, IL1 inhibitor protein, IL1F3 protein, IL1RA protein, IL1RA_HUMAN protein, IL1RN (IL1F3) protein, IL1 RN protein, IL1RN protein, IL1 RA protein, Interleukin 1 receptor antagonist protein, Interleukin-1 receptor antagonist protein protein, Intracellular IL 1 receptor antagonist type II protein, Intracellular interleukin 1 receptor antagonist (icIL 1ra) protein, IRAP protein, MGC10430 protein, MVCD4 protein, Type II interleukin 1 receptor antagonist protein

SDS-PAGE analysis of Horse IL1RA protein (Active)

Quick Database Links

UniProt

O18999