Cart summary

You have no items in your shopping cart.

HOMER3 Rabbit Polyclonal Antibody (FITC)

HOMER3 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2095206

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2095206
CategoryAntibodies
DescriptionHOMER3 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Protein SequenceSynthetic peptide located within the following region: DSRANTVYGLGFASEQHLTQFAEKFQEVKEAARLAREKSQDGGELTSPAL
UniProt IDQ9NSC5
MW39kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesVESL3, HOMER-3
NoteFor research use only
NCBINP_001139193