HNRNPU Rabbit Polyclonal Antibody

• Catalog Number: orb577638
• Category: Antibodies
• Description: Rabbit polyclonal antibody to HNRNPU
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human HNRNPU
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 90kDa
• Target: HNRNPU
• UniProt ID: Q00839
• Protein Sequence: Synthetic peptide located within the following region: EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF
• NCBI: NP_114032
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SAFA, DEE54, HNRPU, SAF-A, U21.1, pp120, EIEE54, G
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-HNRNPU Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: ACHN cell lysate. HNRNPU is strongly supported by BioGPS gene expression data to be expressed in Human ACHN cells.