HNRNPA0 antibody

Catalog Number: orb324888

Catalog Number	orb324888
Category	Antibodies
Description	Rabbit polyclonal antibody to HNRNPA0
Species/Host	Rabbit
Clonality	Polyclonal
Tested applications	ICC, IF, IP, WB
Predicted Reactivity	Bovine, Canine, Human, Porcine
Reactivity	Canine, Human, Porcine
Immunogen	The immunogen is a synthetic peptide directed towards the middle region of human HNRPA0
Concentration	1.0 mg/ml
Form/Appearance	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
MW	34kDa
Target	HNRNPA0
UniProt ID	Q13151
Protein Sequence	Synthetic peptide located within the following region: KAAVVKFHPIQGHRVEVKKAVPKEDIYSGGGGGGSRSSRGGRGGRGRGGG
NCBI	NP_006796
Storage	For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
Buffer/Preservatives	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Alternative names	anti HNRPA0 antibody Read more...
Note	For research use only
Expiration Date	12 months from date of receipt.

Immunohistochemical staining of human Heart tissue using HNRNPA0 antibody

Immunohistochemical staining of human Liver tissue using HNRNPA0 antibody

Immunohistochemical staining of human Heart tissue using HNRNPA0 antibody

Immunohistochemical staining of MCF-7 cell tissue using HNRNPA0 antibody

Immunohistochemical staining of K562 cell tissue using HNRNPA0 antibody

Western blot analysis of HeLa S3, MCF7, K562 tissue using HNRNPA0 antibody

Western blot analysis of Jurkat cell lysate tissue using HNRNPA0 antibody