Cart summary

You have no items in your shopping cart.

HLA-DOA Peptide - N-terminal region

HLA-DOA Peptide - N-terminal region

Catalog Number: orb2002038

DispatchUsually dispatched within 5-10 working days
$ 230.00
Catalog Numberorb2002038
CategoryProteins
DescriptionHLA-DOA Peptide - N-terminal region
Predicted ReactivityHuman
Form/AppearanceLyophilized powder
MW27kDa
UniProt IDP06340
Protein SequenceSynthetic peptide located within the following region: LMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLK
NCBINP_002110
StorageAdd 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Buffer/PreservativesLyophilized powder
Alternative namesHLADZ, HLA-DNA, HLA-DZA
Read more...
NoteFor research use only
Application notesThis is a synthetic peptide designed for use in combination with HLA-DOA Rabbit Polyclonal Antibody (orb326531). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Expiration Date6 months from date of receipt.