Cart summary

You have no items in your shopping cart.

HIV Type-O gp41 13kDa Protein

SKU: orb426154

Description

Recombinant of HIV Type-O gp41 13kDa protein

Images & Validation

Application Notes
Viral Antigens- Human Immunodeficiency Virus

Key Properties

SourceEscherichia Coli
Protein SequenceMGHHHHHHGSVQTHTLLKGIVQQQDNLLRAIQAQQHLLRLSVWGIRQLRARLLALETLI QNQQLLNLWGAKGRLIAYTSVKWNTTWGGGGSIWGNLTWQEWDQQIDNVSSIIYEEIQ KAQDQQEQNEKKLLELDE
PurityGreater than 95.0% as determined by SDS-PAGE.

Storage & Handling

StorageStability: HIV Type-O gp41 although stable at room temperature for 4 weeks, should be stored below -18°C. Please prevent freeze thaw cycles
Form/AppearanceSterile Filtered White lyophilized (freeze-dried) powder.
Buffer/PreservativesLyophilized from 1mg/ml in 20mM Na-carbonate, pH 9.6.
Expiration Date6 months from date of receipt.
DisclaimerFor research use only
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

HIV Type-O gp41 13kDa Protein (orb426154)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μg
$ 330.00
0.5 mg
$ 680.00
1 mg
$ 930.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry