HGH1 Peptide - middle region

• Catalog Number: orb2001136
• Category: Proteins
• Description: HGH1 Peptide - middle region
• Predicted Reactivity: Mouse
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Protein Sequence: Synthetic peptide located within the following region: LRNCCFEHRHHEWLLGPEVDILPFLLLPLAGPEDFSEEEMERLPVDLQYL
• UniProt ID: Q8C3I8
• MW: 43 kDa
• Tested applications: WB
• Application notes: This is a synthetic peptide designed for use in combination with HGH1 Rabbit Polyclonal Antibody (orb55764). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
• Alternative names: BRP16, BRP16L, FAM203A, FAM203B, C8orf30A, C8orf30
• Note: For research use only
• NCBI: NP_057542.2
• Expiration Date: 6 months from date of receipt.