HGH1 Peptide - C-terminal region

• Catalog Number: orb2005297
• Category: Proteins
• Description: HGH1 Peptide - C-terminal region
• Predicted Reactivity: Human
• Form/Appearance: Lyophilized powder
• Buffer/Preservatives: Lyophilized powder
• Protein Sequence: Synthetic peptide located within the following region: ADIRKMLVEAIMLLTATAPGRQQVRDQGAYLILRELHSWEPEPDVRTACE
• UniProt ID: Q9BTY7
• MW: 41kDa
• Tested applications: WB
• Application notes: This is a synthetic peptide designed for use in combination with HGH1 Rabbit Polyclonal Antibody (orb587417). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
• Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
• Alternative names: BRP16, BRP16L, FAM203A, FAM203B, C8orf30A, C8orf30
• Note: For research use only
• NCBI: NP_057542
• Expiration Date: 6 months from date of receipt.