You have no items in your shopping cart.
HBsAg adw2 Protein
SKU: orb81655
Description
Images & Validation
−
| Application Notes |
|---|
Key Properties
−| Source | Escherichia Coli |
|---|---|
| Protein Sequence | MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNH SPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGP CKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFV QWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI |
| Purity | Greater than 90.0% as determined by SDS-PAGE. |
Storage & Handling
−| Storage | Stability: Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles |
|---|---|
| Form/Appearance | Sterile filtered colorless solution. |
| Buffer/Preservatives | Sterile filtered solution containing 50mM potassium phosphate. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Similar Products
−Recombinant Hepatitis B virus genotype A2 subtype adw2 Large envelope protein (S) [orb1674557]
Greater than 90% as determined by SDS-PAGE.
45.1 kDa
in vitro E.coli expression system
100 μg, 20 μgRecombinant Hepatitis B virus genotype A2 subtype adw2 Large envelope protein (S) [orb1674559]
Greater than 85% as determined by SDS-PAGE.
45.1 kDa
in vitro E.coli expression system
100 μg, 20 μgRecombinant Hepatitis B virus genotype A1 subtype adw2 Large envelope protein(S) [orb2914480]
100 μg, 20 μg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
HBsAg adw2 Protein (orb81655)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review

