You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb384353 |
---|---|
Category | Proteins |
Description | HBcAg protein |
Target | HBcAg |
Conjugation | Unconjugated |
Reactivity | Virus |
Form/Appearance | 20mM Tris, 50mM NaCl, 0.5mM DTT, pH 8.5 |
Concentration | 1 mg/ml |
Purity | > 90% |
Protein Sequence | MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHC SPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNVG LKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLP ETTHHHHHH |
UniProt ID | P03148 |
MW | 18.1 kDa |
Tested applications | ELISA, SDS-PAGE, WB |
Application notes | Protein region: 1M-147T, expressed in pET28a |
Biological Origin | E.coli |
Alternative names | HBV Capsid protein |
Note | For research use only |
WB | |
Virus | |
Virus | |
Mouse | |
Monoclonal | |
Unconjugated |
Greater than 90% as determined by SDS-PAGE. | |
23 kDa | |
Yeast |
Greater than 90% as determined by SDS-PAGE. | |
34.3 kDa | |
E.coli |
Greater than 85% as determined by SDS-PAGE. | |
25.4 kDa | |
E.coli |
Greater than 90% as determined by SDS-PAGE. | |
23.8 kDa | |
Baculovirus |